PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_8258AAE78.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 540aa    MW: 62524.6 Da    PI: 8.9045
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_8258AAE78.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR130.51.2e-096484890
                   FAR1 48 tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                           ++k++r+r + r gC a+++v ++  +kw++tkl+leH+H ++
  Traes_7AL_8258AAE78.2  6 SNKKKRKRLSIREGCPAMMEVVRRGPEKWVITKLVLEHTHVIV 48
                           468999**********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.2E-7648IPR004330FAR1 DNA binding domain
PfamPF105512.3E-24133224IPR018289MULE transposase domain
PROSITE profilePS509669.384417449IPR007527Zinc finger, SWIM-type
PfamPF044341.8E-7419447IPR007527Zinc finger, SWIM-type
SMARTSM005750.0071424451IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MLTXSSNKKK RKRLSIREGC PAMMEVVRRG PEKWVITKLV LEHTHVIVSP DKVREVQLLR  60
LSGKEHADQL QEARRNVFGD TGASGLFTYL MRRQSENSGF FYNVQVDGRN CLRNAVWVDA  120
RSKMSYKYFG DAVYFDTTYT QNENMLPFAA FTGMNHHGDC VVFGCALILD KTESSYAWIF  180
ETWLAAMDKR LPFSFTTDEG KTMTEAVAKV FPQCFHRLCR WRVLSKCKKK LSDVYMRFPE  240
LHNELKRCVN ECDTVPVFDM FWGSILDKYG LRENTWLQSL FEARHKWVPA YLTSSFFAEL  300
SLTRRAETIS GFYRNNFSTR APLLSFITTF DQHIDRLYMN EAQKDLALFP PEQLLKTNSI  360
LEKQAASIYT RAAFEFFQTE LIESLHHYAV KVEESPYEAK YYVERDGDPP TRHTVVYNVA  420
EKKAWCDCCR FAFSAILCRH VLGVFILADI DMIPEPCITK RWTKKAKTGP VFVGRILEDE  480
NRHTDSVTSR FSDLVRDAMR CGEKGALSEG SFKFAKEVLR KAYREIDKLT KAGPQQVGNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764420.0AK376442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3124E11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753008.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_014753009.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_014753010.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_014753011.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5H9530.0W5H953_WHEAT; Uncharacterized protein
STRINGMLOC_68272.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-111FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]